PDB entry 2j5s

View 2j5s on RCSB PDB site
Description: structural of abdh, a beta-diketone hydrolase from the cyanobacterium anabaena sp. pcc 7120 bound to (s)-3-oxocyclohexyl acetic acid
Class: hydrolase
Keywords: enzyme evolution, c-c bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone
Deposited on 2006-09-19, released 2007-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: 0.14
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-diketone hydrolase
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5S
    • Uniprot Q8YNV6 (Start-262)
    Domains in SCOPe 2.07: d2j5sa_
  • Chain 'B':
    Compound: beta-diketone hydrolase
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5S
    • Uniprot Q8YNV6 (Start-262)
    Domains in SCOPe 2.07: d2j5sb_
  • Heterogens: KTA, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j5sA (A:)
    mgsshhhhhhmtlnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdaf
    ydisrdrdnrvviltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpv
    isavngaallhseyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgry
    flftqekltaqqayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkr
    lvnegigyglalegitatdlrnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5sA (A:)
    lnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvv
    iltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhs
    eyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqq
    ayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglal
    egitatdlrnt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j5sB (B:)
    mgsshhhhhhmtlnqpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdaf
    ydisrdrdnrvviltgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpv
    isavngaallhseyilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgry
    flftqekltaqqayelnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkr
    lvnegigyglalegitatdlrnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5sB (B:)
    qpeyftkyenlhfhrdengilevrmhtngsslvftgkthrefpdafydisrdrdnrvvil
    tgsgdawmaeidfpslgdvtnprewdktywegkkvlqnlldievpvisavngaallhsey
    ilttdiilasentvfqdmphlnagivpgdgvhilwplalglyrgryflftqekltaqqay
    elnvvhevlpqsklmeraweiartlakqptlnlrytrvaltqrlkrlvnegigyglaleg
    itatdlrnt