PDB entry 2j5m

View 2j5m on RCSB PDB site
Description: Structure of Chloroperoxidase Compound 0
Class: oxidoreductase
Keywords: oxidoreductase, pyrrolidone carboxylic acid, glycoprotein, metal-binding, peroxidase
Deposited on 2006-09-18, released 2006-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.198
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloroperoxidase
    Species: Leptoxyphium fumago [TaxId:5474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j5ma1, d2j5ma2
  • Heterogens: MN, HEM, PEO, NAG, MAN, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j5mA (A:)
    eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln
    hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva
    nsndfidnrnfdaetfqtsldvvagkthfdyadmneirlqreslsneldfpgwfteskpi
    qnvesgfifalvsdfnlpdndenplvridwwkywftnesfpyhlgwhppspareiefvts
    assavlaasvtstpsslpsgaigpgaeavplsfastmtpfllatnapyyaqdptlgpnd