PDB entry 2j5l

View 2j5l on RCSB PDB site
Description: structure of a plasmodium falciparum apical membrane antigen 1-fab f8.12.19 complex
Class: immune system
Keywords: malaria vaccine candidate, apical membrane antigen 1, hypothetical protein, immunoglobulin domain, membrane, merozoite, transmembrane, immune system, immunoglobulin c region, antibody cross-reactivity
Deposited on 2006-09-18, released 2007-01-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.215
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apical membrane antigen 1
    Species: PLASMODIUM FALCIPARUM [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9GVB7
      • engineered mutation (466)
    Domains in SCOPe 2.03: d2j5la1
  • Chain 'B':
    Compound: fab fragment of monoclonal antibody f8.12.19
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5L (0-End)
    Domains in SCOPe 2.03: d2j5lb1, d2j5lb2
  • Chain 'C':
    Compound: fab fragment of monoclonal antibody f8.12.19
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.03: d2j5lc1, d2j5lc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j5lA (A:)
    qksdvyhpinehrehpkeyeyplhqehtyqqedsgedentlqhaypidhegaepapqeqn
    lfssieiversnymgnpwteymakydieevhgsgirvdlgedaevagtqyrlpsgkcpvf
    gkgiiiensnttflkpvatgnqdlkdggfafpptnplispmtlngmrdfyknneyvknld
    eltlcsrhagnmnpdndknsnykypavydyndkkchilyiaaqenngprycnkdqskrns
    mfcfrpakdklfenytylsknvvdnweevcprknlenakfglwvdgncediphvnefsan
    dlfecnklvfelsasdqpkqyeqhltdyekikegfknknasmiksaflptgafkadryks
    hgkgynwgnynretqkceifnvkptclinnssyiattalshpievehnfpcslykdeikk
    eiereskriklndnddegnkkiiaprifisddkdslkcpcdpemvsqstcrffvckcver
    raevtsnnevvvkeeykdeyadipehkptydnmkiiiassaavavlatilmvylykrkgn
    aekydkmdqpqhygkstsrndemldpeasfwgeekrashtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5lA (A:)
    ifisddkdslkcpcdpemvsqstcrffvckcver
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j5lB (B:)
    esvlsqspailsaspgekvtmtcrarssvsymhwyqqksgsspkpwihatsnlasgvpar
    fsgsgsgtsysltisrveaedaatyycqqwsshpptfgsgtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j5lC (C:)
    evqlvesggglvkpggslklscaasgfifsdyymywvrqtpekrlewvatisdgnsytyy
    vdsvkgrftisrdnaknnlylqmsslksedtaiyycardgptdssgyggfgywgqgtlvt
    vseakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc