PDB entry 2j5h

View 2j5h on RCSB PDB site
Description: nmr analysis of mouse cripto cfc domain
Class: hormone/growth factor
Keywords: growth factor, egf-cfc family, cripto, tumour progression, cysteine-rich domains, hormone/growth factor complex
Deposited on 2006-09-18, released 2006-10-02
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-30, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: teratocarcinoma-derived growth factor
  Database cross-references and differences (RAF-indexed):
  • PDB 2J5H (0-38)
  Domains in SCOP 1.73: d2j5ha1
• Heterogens: ACE, NH2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2j5hA (A:)
  kehcgsilhgtwlpkkcslcrcwhgqlhclpqtflpgcd