PDB entry 2j5h

View 2j5h on RCSB PDB site
Description: NMR analysis of mouse CRIPTO CFC domain
Class: hormone/growth factor
Keywords: hormone/growth factor, growth factor, egf-cfc family, cripto, tumour progression, cysteine-rich domains, hormone-growth factor complex
Deposited on 2006-09-18, released 2006-10-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: teratocarcinoma-derived growth factor
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J5H
    • Uniprot P51865 (0-38)
    Domains in SCOPe 2.08: d2j5ha1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j5hA (A:)
    kehcgsilhgtwlpkkcslcrcwhgqlhclpqtflpgcd