PDB entry 2j5f

View 2j5f on RCSB PDB site
Description: crystal structure of egfr kinase domain in complex with an irreversible inhibitor 34-jab
Class: transferase
Keywords: cell cycle, ATP-binding, transferase, polymorphism, irreversible inhibitor, tyrosine-protein kinase, egfr, kinase, 34-jab, membrane, receptor, wild-type, epidermal growth factor, anti-oncogene, transmembrane, nucleotide-binding, alternative splicing, ubl conjugation, phosphorylation, disease mutation, glycoprotein
Deposited on 2006-09-14, released 2007-02-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.194
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2j5fa_
  • Heterogens: DJK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j5fA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
    nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
    nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggk
    vpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpq
    ppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptds
    nfyralmdeedmddvvdadeylipqqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j5fA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspka
    nkeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyll
    nwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekvpikwmal
    esilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidv
    ymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsplmdeedmddvv
    dadeylipq