PDB entry 2j56

View 2j56 on RCSB PDB site
Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase n-semiquinone in complex with amicyanin.
Class: oxidoreductase
Keywords: oxidoreductase, periplasmic, metal-binding, electron transport, single crystal microspectrophotometry
Deposited on 2006-09-12, released 2007-01-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.171
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2j56a_
  • Chain 'B':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2j56b_
  • Chain 'H':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29894 (Start-385)
      • see remark 999 (311-312)
    Domains in SCOPe 2.04: d2j56h_
  • Chain 'J':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29894 (Start-385)
      • see remark 999 (311-312)
    Domains in SCOPe 2.04: d2j56j_
  • Chain 'L':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2j56l_
  • Chain 'M':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2j56m_
  • Heterogens: CU, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j56A (A:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j56B (B:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2j56H (H:)
    qdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtq
    qfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtll
    ptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpd
    cyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrl
    vwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdq
    rdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihd
    aesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j56H (H:)
    etqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagrv
    igmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpdap
    rflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapdt
    ffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkihq
    idlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktasr
    fvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsvn
    qlghgpqvittadmg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2j56J (J:)
    qdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtq
    qfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtll
    ptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpd
    cyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrl
    vwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdq
    rdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihd
    aesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j56J (J:)
    etqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagrv
    igmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpdap
    rflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapdt
    ffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkihq
    idlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktasr
    fvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsvn
    qlghgpqvittadmg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2j56L (L:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j56L (L:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2j56M (M:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j56M (M:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas