PDB entry 2j55

View 2j55 on RCSB PDB site
Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase o-quinone in complex with amicyanin.
Class: oxidoreductase
Keywords: copper, transport, periplasmic, metal-binding, oxidoreductase, electron transport, methylamine dehydrogenase single crystal microspectrophoto
Deposited on 2006-09-12, released 2007-01-23
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-23, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.192
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j55a1
  • Chain 'B':
    Compound: amicyanin
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j55b1
  • Chain 'H':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29894 (Start-385)
      • conflict see remark 9 (311-312)
    Domains in SCOP 1.73: d2j55h1
  • Chain 'J':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29894 (Start-385)
      • conflict see remark 9 (311-312)
    Domains in SCOP 1.73: d2j55j1
  • Chain 'L':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j55A (A:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j55B (B:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2j55H (H:)
    qdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtq
    qfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtll
    ptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpd
    cyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrl
    vwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdq
    rdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihd
    aesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j55H (H:)
    eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvi
    dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
    ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
    fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
    ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
    rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
    eelrsvnqlghgpqvittadmg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2j55J (J:)
    qdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtq
    qfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtll
    ptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpd
    cyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrl
    vwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdq
    rdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihd
    aesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j55J (J:)
    aetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvid
    geagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadi
    elpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhif
    ptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpty
    tgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewr
    hktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesge
    elrsvnqlghgpqvittadmg
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.