PDB entry 2j4z

View 2j4z on RCSB PDB site
Description: Structure of Aurora-2 in complex with PHA-680626
Class: transferase
Keywords: transferase, phosphorylation, nucleotide-binding, kinase, cell cycle, ATP-binding, nucleotide- binding, serine/threonine-protein kinase, serine-threonine-protein kinase
Deposited on 2006-09-08, released 2006-11-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j4za_
  • Chain 'B':
    Compound: serine threonine-protein kinase 6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j4zb_
  • Heterogens: 626, ARS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j4zA (A:)
    gpqplpsapennpeeelaskqkneeskkrqwaledfeigrplgkgkfgnvylarekqskf
    ilalkvlfkaqlekagvehqlrreveiqshlrhpnilrlygyfhdatrvylileyaplgt
    vyrelqklskfdeqrtatyitelanalsychskrvihrdikpenlllgsagelkiadfgw
    svhapssrrttlcgtldylppemiegrmhdekvdlwslgvlcyeflvgkppfeantyqet
    ykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpwitansskpsncqnke
    saskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4zA (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm
    hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
    hnpsqrpmlrevlehpwitanssk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j4zB (B:)
    gpqplpsapennpeeelaskqkneeskkrqwaledfeigrplgkgkfgnvylarekqskf
    ilalkvlfkaqlekagvehqlrreveiqshlrhpnilrlygyfhdatrvylileyaplgt
    vyrelqklskfdeqrtatyitelanalsychskrvihrdikpenlllgsagelkiadfgw
    svhapssrrttlcgtldylppemiegrmhdekvdlwslgvlcyeflvgkppfeantyqet
    ykrisrveftfpdfvtegardlisrllkhnpsqrpmlrevlehpwitansskpsncqnke
    saskqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4zB (B:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegrm
    hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
    hnpsqrpmlrevlehpwitansskpsncqn