PDB entry 2j4w

View 2j4w on RCSB PDB site
Description: structure of a plasmodium vivax apical membrane antigen 1-fab f8.12.19 complex
Class: immune system
Keywords: immunoglobulin domain, immunoglobulin c region, membrane, transmembrane, hypothetical protein, antibody cross-reactivity, surface active protein, malaria vaccine candidate, apical membrane antigen 1, immune system
Deposited on 2006-09-07, released 2007-01-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: apical membrane antigen 1
    Species: PLASMODIUM VIVAX [TaxId:5855]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9TY14
      • engineered mutation (398)
    Domains in SCOPe 2.05: d2j4wd1
  • Chain 'H':
    Compound: fab fragment of monoclonal antibody f8.12.19
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J4W (0-210)
    Domains in SCOPe 2.05: d2j4wh1, d2j4wh2
  • Chain 'L':
    Compound: fab fragment of monoclonal antibody f8.12.19
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.05: d2j4wl1, d2j4wl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j4wD (D:)
    ptverstrmgnpwkafmekydierthssgvrvdlgedaevenakyripagrcpvfgkgiv
    iensdvsflrpvatgdqklkdggfafpnandhispmtlanlkerykdnvemmklndialc
    rthaasfvmagdqnsnyrhpavydekektchmlylsaqenmgprycspdaqnrdavfcfk
    pdkdesfenlvylsknvrndwdkkcprknlgnakfglwvdgnceeipyvkeveaedlrec
    nrivfgasasdqptqyeeemtdyqkiqqgfrqnnremikgaflpvgafnsdnfkskgrgf
    nwanfdsvkrkcyifntkptclindknfiattalshpqevdlefpcsiykdeiereikkq
    srnmnlysvdgerivlprifisndkesikcpceperisestcnfyvcncvekraeikeln
    qvvikeefrlyyelgeeksnkqmll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4wD (D:)
    ifisndkesikcpceperisestcnfyvcncvek
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j4wH (H:)
    evqlvesggglvkpggslklscaasgfifsdyymywvrqtpekrlewvatisdgnsytyy
    vdsvkgrftisrdnaknnlylqmsslksedtaiyycardgptdssgyggfgywgqgtlvt
    vseakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j4wL (L:)
    esvlsqspailsaspgekvtmtcrarssvsymhwyqqksgsspkpwihatsnlasgvpar
    fsgsgsgtsysltisrveaedaatyycqqwsshpptfgsgtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec