PDB entry 2j4q

View 2j4q on RCSB PDB site
Description: Crystal structure of a E138A Escherichia coli dCTP deaminase mutant enzyme in complex with dTTP
Class: hydrolase
Keywords: nucleotide metabolism, trimer, hydrolase, dctp deaminase
Deposited on 2006-09-05, released 2007-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxycytidine triphosphate deaminase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28248 (0-End)
      • engineered mutation (137)
    Domains in SCOPe 2.08: d2j4qa_
  • Chain 'B':
    Compound: deoxycytidine triphosphate deaminase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28248 (0-End)
      • engineered mutation (137)
    Domains in SCOPe 2.08: d2j4qb_
  • Heterogens: TYD, TTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j4qA (A:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4qA (A:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j4qB (B:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4qB (B:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpy