PDB entry 2j4h

View 2j4h on RCSB PDB site
Description: Crystal structure of a H121A Escherichia coli dCTP deaminase mutant enzyme
Class: hydrolase
Keywords: dctp deaminase, hydrolase, nucleotide metabolism, trimer
Deposited on 2006-08-31, released 2007-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxycytidine triphosphate deaminase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28248 (0-End)
      • engineered mutation (120)
    Domains in SCOPe 2.08: d2j4ha_
  • Chain 'B':
    Compound: deoxycytidine triphosphate deaminase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28248 (0-End)
      • engineered mutation (120)
    Domains in SCOPe 2.08: d2j4hb_
  • Heterogens: YYY, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j4hA (A:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    avtahridpgwsgcivlefynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4hA (A:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    avtahridpgwsgcivlefynsgklplalrpgmligalsfeplsgpavrpynrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j4hB (B:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    avtahridpgwsgcivlefynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4hB (B:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    avtahridpgwsgcivlefynsgklplalrpgmligalsfeplsgpavrpyn