PDB entry 2j4g

View 2j4g on RCSB PDB site
Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with n-butyl-thiazoline inhibitor
Class: inhibitor
Keywords: gh84, enzyme, thiazoline, inhibition, o-glcnacase, inhibitor
Deposited on 2006-08-31, released 2007-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.223
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hyaluronoglucosaminidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4ga1, d2j4ga2, d2j4ga3
  • Chain 'B':
    Compound: Hyaluronoglucosaminidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j4gb1, d2j4gb2, d2j4gb3
  • Heterogens: NB1, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j4gA (A:)
    nvslqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisige
    kgdksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpevei
    kdypsvryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpyp
    dkeaaqlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavff
    ddisgegtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdkl
    npsiqimwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndtt
    iakemsgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecf
    amhnsdlgpnghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesadi
    llmntenkpliveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyi
    dqtsnqnpyqpgvktatrvikplidrtfatvvkffnqkfnahldattdymphkmisnveq
    iknlplqvkanrvlispanevvkwaagnsveieldaiypgeniqinfgkdapctwgrlei
    stdgkewktvdlkqkesrlsaglqkapvkfvrftnvsdeeqqvylrqfvltiekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4gA (A:)
    slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
    dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
    ypsvryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdk
    eaaqlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffdd
    isgegtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnp
    siqimwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttia
    kemsgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfam
    hnsdlgpnghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesadill
    mntenkpliveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidq
    tsnqnpyqpgvktatrvikplidrtfatvvkffnqkfnahldattd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j4gB (B:)
    nvslqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisige
    kgdksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpevei
    kdypsvryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpyp
    dkeaaqlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavff
    ddisgegtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdkl
    npsiqimwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndtt
    iakemsgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecf
    amhnsdlgpnghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesadi
    llmntenkpliveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyi
    dqtsnqnpyqpgvktatrvikplidrtfatvvkffnqkfnahldattdymphkmisnveq
    iknlplqvkanrvlispanevvkwaagnsveieldaiypgeniqinfgkdapctwgrlei
    stdgkewktvdlkqkesrlsaglqkapvkfvrftnvsdeeqqvylrqfvltiekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4gB (B:)
    slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsgmlisigekgdks
    vrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps
    vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
    qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg
    egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswspngnylttlgdklnpsiqi
    mwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakems
    gfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhnsd
    lgpnghgyrreesmdiqpaaerflkafgknydkadfetlqytfermkesadillmntenk
    pliveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnp
    yqpgvktatrvikplidrtfatvvkffnqkfnahldattd