PDB entry 2j4b

View 2j4b on RCSB PDB site
Description: crystal structure of encephalitozoon cuniculi taf5 n-terminal domain
Class: transcription
Keywords: taf5, tfiid, wd repeat, initiation, transcription, initiation factor
Deposited on 2006-08-28, released 2007-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription initiation factor tfiid subunit 72/90-100 kda
    Species: Encephalitozoon cuniculi [TaxId:6035]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j4ba1
  • Chain 'B':
    Compound: transcription initiation factor tfiid subunit 72/90-100 kda
    Species: Encephalitozoon cuniculi [TaxId:6035]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J4B
    • Uniprot Q8SQS4 (Start-137)
    Domains in SCOPe 2.08: d2j4bb_
  • Chain 'C':
    Compound: transcription initiation factor tfiid subunit 72/90-100 kda
    Species: Encephalitozoon cuniculi [TaxId:6035]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J4B
    • Uniprot Q8SQS4 (4-End)
    Domains in SCOPe 2.08: d2j4bc_
  • Chain 'D':
    Compound: transcription initiation factor tfiid subunit 72/90-100 kda
    Species: Encephalitozoon cuniculi [TaxId:6035]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j4bd_
  • Chain 'E':
    Compound: transcription initiation factor tfiid subunit 72/90-100 kda
    Species: Encephalitozoon cuniculi [TaxId:6035]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j4be_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j4bA (A:)
    gshmkdqmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffek
    yrgdhynkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernlt
    yilkilnqhldikvyvgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4bA (A:)
    qmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffekyrgdhk
    seeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernltyilkilnq
    hldikvyvg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j4bB (B:)
    gshmkdqmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffek
    yrgdhynkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernlt
    yilkilnqhldikvyvgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4bB (B:)
    dqmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffekyrgdh
    ynkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernltyilki
    lnqhldikvyvgp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j4bC (C:)
    gshmkdqmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffek
    yrgdhynkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernlt
    yilkilnqhldikvyvgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4bC (C:)
    kdqmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffekyrgd
    hynkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernltyilk
    ilnqhldikvyvg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j4bD (D:)
    gshmkdqmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffek
    yrgdhynkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernlt
    yilkilnqhldikvyvgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4bD (D:)
    qmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffekyrgdhy
    nkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernltyilkil
    nqhldikvyvg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j4bE (E:)
    gshmkdqmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffek
    yrgdhynkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernlt
    yilkilnqhldikvyvgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j4bE (E:)
    qmetsyvslktwiedsldlfkndllpllyplfihiyfdliqqnktdeakeffekyrgdhy
    nkseeikqfesiytvqhihennfaytfknskyhlsmgryafdllinfleernltyilkil
    nqhldikvyv