PDB entry 2j49

View 2j49 on RCSB PDB site
Description: crystal structure of yeast taf5 n-terminal domain
Class: transcription
Keywords: transcription, nuclear protein, transcription regulation, taf5, tfiid, wd repeat, initiation
Deposited on 2006-08-28, released 2007-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.221
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor TFIID subunit 5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j49a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j49A (A:)
    gshmnapenyiraysmlknwvdssleiykpelsyimypifiylflnlvaknpvyarrffd
    rfspdfkdfhgseinrlfsvnsidhikenevasafqshkyritmskttlnlllyflnene
    siggsliisvinqhldpnivesvtarek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j49A (A:)
    penyiraysmlknwvdssleiykpelsyimypifiylflnlvaknpvyarrffdrfspdf
    kdfhgseinrlfsvnsidhikenevasafqshkyritmskttlnlllyflnenesiggsl
    iisvinqhldpniv