PDB entry 2j47

View 2j47 on RCSB PDB site
Description: bacteroides thetaiotaomicron gh84 o-glcnacase in complex with a imidazole-pugnac hybrid inhibitor
Class: inhibitor
Keywords: inhibitor, o-glcnacase, imidazole, gh84, pugnac, enzyme, inhibition
Deposited on 2006-08-25, released 2006-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.193
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosaminidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j47a1, d2j47a2, d2j47a3
  • Heterogens: GDV, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j47A (A:)
    qnvslqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisig
    ekgdksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeve
    ikdypsvryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpy
    pdkeaaqlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavf
    fddisgegtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdk
    lnpsiqimwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndt
    tiakemsgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelec
    famhnsdlgpnghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesad
    illmntenkpliveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfy
    idqtsnqnpyqpgvktatrvikplidrtfatvvkffnqkfnahldattdymphkmisnve
    qiknlplqvkanrvlispanevvkwaagnsveieldaiypgeniqinfgkdapctwgrle
    istdgkewktvdlkqkesrlsaglqkapvkfvrftnvsdeeqqvylrqfvltiekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j47A (A:)
    slqpppqqlivqnktidyqlnggeeanphavkvlkellsggmlisigekgdksvrkysrq
    ipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdypsvryrgvv
    egfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaaqlqelva
    vanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisgegtnpqk
    qaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiqimwtgdr
    visditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakemsgfvtnp
    mehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhnsdlgpngh
    gyrreesmdiqpaaerflkafkydkadfetlqytfermkesadillmntenkpliveitp
    wvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkta
    trvikplidrtfatvvkffnqkfnahldattd