PDB entry 2j46

View 2j46 on RCSB PDB site
Description: water structure of t. aquaticus ffh ng domain at 1.1a resolution
Class: nucleotide-binding
Keywords: ribonucleoprotein, nucleotide-binding, srp, ffh, water, gtpase, RNA-binding, GTP-binding, signal recognition particle
Deposited on 2006-08-24, released 2006-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: 0.15
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle protein
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J46 (0-0)
    • Uniprot O07347 (1-End)
    Domains in SCOPe 2.06: d2j46a1, d2j46a2
  • Chain 'B':
    Compound: signal recognition particle protein
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J46 (0-0)
    • Uniprot O07347 (1-296)
    Domains in SCOPe 2.06: d2j46b1, d2j46b2
  • Heterogens: MRD, CL, ACT, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j46A (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j46A (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j46B (B:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdv