PDB entry 2j45

View 2j45 on RCSB PDB site
Description: water structure of t. aquaticus ffh ng domain at 1.1a resolution
Class: nucleotide binding
Keywords: ribonucleoprotein, nucleotide-binding, srp, ffh, water, gtpase, RNA-binding, GTP-binding, signal recognition particle, nucleotide binding
Deposited on 2006-08-24, released 2006-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: 0.121
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle protein
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J45 (0-0)
    • Uniprot O07347 (1-296)
    Domains in SCOPe 2.07: d2j45a1, d2j45a2
  • Chain 'B':
    Compound: signal recognition particle protein
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J45 (0-0)
    • Uniprot O07347 (1-296)
    Domains in SCOPe 2.07: d2j45b1, d2j45b2
  • Heterogens: NA, MRD, MES, CA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j45A (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j45B (B:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdv