PDB entry 2j3w

View 2j3w on RCSB PDB site
Description: The crystal structure of the bet3-trs31-sedlin complex.
Class: transport
Keywords: multisubunit tethering factor, trapp, palmitate, transport, lipoprotein, er-golgi transport, endoplasmic reticulum, transcription, golgi apparatus, vesicle transport
Deposited on 2006-08-23, released 2006-11-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2296
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trafficking protein particle complex protein 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J3W (0-1)
    • Uniprot Q9CQP2 (2-141)
    Domains in SCOPe 2.08: d2j3wa_
  • Chain 'B':
    Compound: zgc 92866
    Species: BRACHYDANIO RERIO [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j3wb1
  • Chain 'C':
    Compound: trafficking protein particle complex protein 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J3W (0-1)
    • Uniprot Q9CQP2 (2-141)
    Domains in SCOPe 2.08: d2j3wc_
  • Chain 'D':
    Compound: Trafficking protein particle complex subunit 3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j3wd_
  • Chain 'E':
    Compound: Trafficking protein particle complex subunit 3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j3we_
  • Chain 'F':
    Compound: zgc 92866
    Species: BRACHYDANIO RERIO [TaxId:7955]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j3wf_
  • Heterogens: PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j3wA (A:)
    lemsgsfyfvivghhdnpvfemeflppgkaeskddhrhlnqfiahaaldlvdenmwlsnn
    mylktvdkfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepn
    spirssafdrkvqflgkkhlls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j3wB (B:)
    mevrftrgksailersltrpktevsvsafallfsemvqycqsrvysvselqarladmgqg
    vgaslldvlvmrekngkretkvlnillfikvnvwkalfgkeadkleqandddktyyiiek
    eplinayisvpkenstlncaaftggiveailthsgfpakvtvhwhkgttlmikfdesvia
    rdkaldgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j3wB (B:)
    ktevsvsafallfsemvqycqsrvysvselqarladmgqgvgaslldvlvmrekngkret
    kvlnillfikvnvwkalfgkeadkleqandddktyyiiekeplinayisvpkenstlnca
    aftggiveailthsgfpakvtvhwhkgttlmikfdesviardkaldgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j3wC (C:)
    lemsgsfyfvivghhdnpvfemeflppgkaeskddhrhlnqfiahaaldlvdenmwlsnn
    mylktvdkfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepn
    spirssafdrkvqflgkkhlls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j3wC (C:)
    lemsgsfyfvivghhdnpvfemeflppgkrhlnqfiahaaldlvdenmwlsnnmylktvd
    kfnewfvsafvtaghmrfimlhdvrqedgiknfftdvydlyikfamnpfyepnspirssa
    fdrkvqflgkkhlls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j3wD (D:)
    gamsrqanrgteskkmsselftltygalvtqlckdyendedvnkqldrmgynigvrlied
    flarsnvgrchdfretadviakvafkmylgitpsitnwspagdefslilennplvdfvel
    pdnhsaliysnllcgvlrgalemvqmaveakfvqdtlkgdgvteirmrfirriednlpag
    ee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j3wD (D:)
    kmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnchdfreta
    dviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnllcgvl
    rgalemvqmaveakfvqdtlkgdgvteirmrfirried
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j3wE (E:)
    gamsrqanrgteskkmsselftltygalvtqlckdyendedvnkqldrmgynigvrlied
    flarsnvgrchdfretadviakvafkmylgitpsitnwspagdefslilennplvdfvel
    pdnhsaliysnllcgvlrgalemvqmaveakfvqdtlkgdgvteirmrfirriednlpag
    ee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j3wE (E:)
    kkmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnchdfret
    adviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnllcgv
    lrgalemvqmaveakfvqdtlkgdgvteirmrfirried
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2j3wF (F:)
    mevrftrgksailersltrpktevsvsafallfsemvqycqsrvysvselqarladmgqg
    vgaslldvlvmrekngkretkvlnillfikvnvwkalfgkeadkleqandddktyyiiek
    eplinayisvpkenstlncaaftggiveailthsgfpakvtvhwhkgttlmikfdesvia
    rdkaldgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j3wF (F:)
    tevsvsafallfsemvqycqsrvysvselqarladmgqgvgaslldvlvmrekngkretk
    vlnillfikvnvwkalfgkeadkleqandddktyyiiekeplinayisvpkenstlncaa
    ftggiveailthsgfpakvtvhwhkgttlmikfdesviardkaldgr