PDB entry 2j3s

View 2j3s on RCSB PDB site
Description: crystal structure of the human filamin a ig domains 19 to 21
Class: structural protein
Keywords: acetylation, polymorphism, cytoskeleton, disease mutation, actin-binding, phosphorylation, immunoglobulin like, structural protein
Deposited on 2006-08-23, released 2007-10-16
The last revision prior to the SCOP 1.75 freeze date was dated 2008-03-11, with a file datestamp of 2008-03-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.25698
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin-A
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2J3S (Start-2)
    • Uniprot P21333 (3-287)
    Domains in SCOP 1.75: d2j3sa1, d2j3sa2
  • Chain 'B':
    Compound: Filamin-A
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • PDB 2J3S (Start-2)
    • Uniprot P21333 (3-287)
    Domains in SCOP 1.75: d2j3sb1, d2j3sb2
  • Heterogens: BR, DIO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j3sA (A:)
    gamgdasrvrvsgqglheghtfepaefiidtrdagygglslsiegpskvdintedledgt
    crvtycptepgnyiinikfadqhvpgspfsvkvtgegrvkesitrrrrapsvanvgshcd
    lslkipeisiqdmtaqvtspsgktheaeivegenhtycirfvpaemgthtvsvkykgqhv
    pgspfqftvgplgeggahkvraggpgleraeagvpaefsiwtreagagglaiavegpska
    eisfedrkdgscgvayvvqepgdyevsvkfneehipdspfvvpvasps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j3sA (A:)
    mgdasrvrvsgqglheghtfepaefiidtrdagygglslsiegpskvdintedledgtcr
    vtycptepgnyiinikfadqhvpgspfsvkvtgegrvkesitrrrrapsvanvgshcdli
    qdmtaqvtspsgktheaeiycirfvpaemgthtvsvkykgqhvpgspfqftvgplgegga
    hkvraggpgleraeagvpaefsiwtreagagglaiavegpskaeisfedrkdgscgvayv
    vqepgdyevsvkfneehipdspfvvpvasps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j3sB (B:)
    gamgdasrvrvsgqglheghtfepaefiidtrdagygglslsiegpskvdintedledgt
    crvtycptepgnyiinikfadqhvpgspfsvkvtgegrvkesitrrrrapsvanvgshcd
    lslkipeisiqdmtaqvtspsgktheaeivegenhtycirfvpaemgthtvsvkykgqhv
    pgspfqftvgplgeggahkvraggpgleraeagvpaefsiwtreagagglaiavegpska
    eisfedrkdgscgvayvvqepgdyevsvkfneehipdspfvvpvasps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j3sB (B:)
    mgdasrvrvsgqglheghtfepaefiidtrdagygglslsiegpskvdintedledgtcr
    vtycptepgnyiinikfadqhvpgspfsvkvtgegrvkesitrrrrapsvanvghcdirf
    vpaemgthtvftvgpggahkvraggpgleraeagvpaefsiwtreagagglaiavegpsk
    aeisfedrkdgscgvayvvqepgdyevsvkfneehipdspfvvpvasps