PDB entry 2j37

View 2j37 on RCSB PDB site
Description: model of mammalian srp bound to 80s rncs
Class: ribosome
Keywords: ribosome, srp, translation/RNA
Deposited on 2006-08-18, released 2006-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: EM
Resolution: 8 Å
R-factor: N/A
AEROSPACI score: -0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '4':
    Compound: 60s ribosomal protein l23
    Species: Triticum sp. [TaxId:4569]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J37
  • Chain '5':
    Compound: ribosomal protein L35
    Species: TRITICUM SP. [TaxId:4569]
    Database cross-references and differences (RAF-indexed):
  • Chain '6':
    Compound: ribosomal protein L31
    Species: TRITICUM SP [TaxId:4569]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J37
  • Chain 'A':
    Compound: srp RNA
    Species: Canis sp. [TaxId:9616]
  • Chain 'B':
    Compound: Signal recognition particle 19 kDa protein (SRP19)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J37
    • Uniprot P09132 (1-107)
    Domains in SCOPe 2.08: d2j37b1
  • Chain 'S':
    Compound: signal sequence
    Species: Canis sp. [TaxId:9616]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J37 (0-16)
  • Chain 'W':
    Compound: Signal recognition particle 54 kDa protein (SRP54)
    Species: Canis sp. [TaxId:9616]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Z':
    Compound: ribosomal RNA
    Species: Haloarcula marismortui [TaxId:2238]

PDB Chain Sequences:

  • Chain '4':
    No sequence available.

  • Chain '5':
    No sequence available.

  • Chain '6':
    No sequence available.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2j37B (B:)
mrficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvfleknkmysrew
nrdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktrtq

    Sequence, based on observed residues (ATOM records): (download) 
    >2j37B (B:)
rficiypaylnnkktiaegrripiskavenptateiqdvcsavglnvfleknkmysrewn
rdvqyrgrvrvqlkqedgslclvqfpsrksvmlyaaemipklktrtq

  • Chain 'S':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'Z':
    No sequence available.