PDB entry 2j2s

View 2j2s on RCSB PDB site
Description: Solution structure of the nonmethyl-CpG-binding CXXC domain of the leukaemia-associated MLL histone methyltransferase
Class: transcription regulation
Keywords: transcription regulation, chromosomal rearrangement, zinc-finger, DNA-binding, bromodomain, polymorphism, mixed lineage leukaemia, zinc binding, transcription, metal-binding, zinc, cxxc, mbd1, hox genes, chromatin, methylation, proto-oncogene, nuclear protein, phosphorylation, cpg dinucleotide, alternative splicing
Deposited on 2006-08-17, released 2006-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Zinc finger protein HRX
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q03164 (0-71)
    • engineered mutation (0-2)
  Domains in SCOPe 2.08: d2j2sa_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2j2sA (A:)
  ggsvkkgrrsrrcgqcpgcqvpedcgvctncldkpkfggrnikkqcckmrkcqnlqwmps
  kaylqkqakavk