PDB entry 2j2j

View 2j2j on RCSB PDB site
Description: canine adenovirus fibre head at 1.5 a resolution
Class: viral protein
Keywords: fiber protein, canine adenovirus, ad, car, knob, head, fiber fibre, adenovirus, coxsackievirus, adenovirus receptor, viral protein
Deposited on 2006-08-16, released 2006-09-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.165
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J2J
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.01: d2j2ja_
  • Chain 'B':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J2J
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.01: d2j2jb_
  • Chain 'C':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J2J
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.01: d2j2jc_
  • Chain 'D':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J2J
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.01: d2j2jd_
  • Chain 'E':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J2J
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.01: d2j2je_
  • Chain 'F':
    Compound: fiber protein
    Species: CANINE ADENOVIRUS 2 [TaxId:10514]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J2J
    • Uniprot Q65914 (Start-196)
    Domains in SCOPe 2.01: d2j2jf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j2jA (A:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j2jA (A:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j2jB (B:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j2jB (B:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j2jC (C:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j2jC (C:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j2jD (D:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j2jD (D:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j2jE (E:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j2jE (E:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2j2jF (F:)
    mrgshhhhhhgsppaapitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvge
    ggyrivsptqsqfslimefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmp
    nrevystpaatisrcgldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsgg
    tlfktdvltftyvgenq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j2jF (F:)
    apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
    imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
    gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
    nq