PDB entry 2j27

View 2j27 on RCSB PDB site
Description: the functional role of the conserved active site proline of triosephosphate isomerase
Class: isomerase
Keywords: tim, 2pg, loop7, isomerase, glycosome, tim-barrel, gluconeogenesis, lipid synthesis, atomic resolution, glycolysis, pentose shunt, point mutation, fatty acid biosynthesis, 2-phospho glycolate, protein engineering
Deposited on 2006-08-16, released 2007-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.1417
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-249)
      • engineered mutation (167)
    Domains in SCOPe 2.07: d2j27a_
  • Chain 'B':
    Compound: triosephosphate isomerase glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-249)
      • engineered mutation (167)
    Domains in SCOPe 2.07: d2j27b_
  • Heterogens: PGA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j27A (A:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayeavwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j27A (A:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
    iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
    mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayeavwaigtgkvatpq
    qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
    fvdiikatq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j27B (B:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayeavwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j27B (B:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
    iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
    mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayeavwaigtgkvatpq
    qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
    fvdiikatq