PDB entry 2j24

View 2j24 on RCSB PDB site
Description: the functional role of the conserved active site proline of triosephosphate isomerase
Class: isomerase
Keywords: isomerase, protein engineering, fatty acid biosynthesis, gluconeogenesis, lipid synthesis, pentose shunt, point mutation, loop7, glycosome, tim-barrel
Deposited on 2006-08-16, released 2007-01-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.153
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-249)
      • engineered mutation (167)
    Domains in SCOPe 2.01: d2j24a_
  • Chain 'B':
    Compound: Triosephosphate isomerase, glycosomal
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-249)
      • engineered mutation (167)
    Domains in SCOPe 2.01: d2j24b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j24A (A:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayeavwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j24A (A:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
    iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
    mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayeavwaigtgkvatpq
    qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
    fvdiikatq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j24B (B:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkf
    viaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasg
    fmviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayeavwaigtgkvatp
    qqaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkp
    efvdiikatq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j24B (B:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfv
    iaaqnaiaksgaftgevslpilkdfgvnwivlghserrayygetneivadkvaaavasgf
    mviacigetlqeresgrtavvvltqiaaiakklkkadwakvviayeavwaigtgkvatpq
    qaqeahalirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpe
    fvdiikatq