PDB entry 2j1q

View 2j1q on RCSB PDB site
Description: crystal structure of trypanosoma cruzi arginine kinase
Class: transferase
Keywords: kinase, transferase, arginine kinase, guanidino kinase, phosphagen kinase, trypanosoma cruzi
Deposited on 2006-08-15, released 2007-07-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: Trypanosoma cruzi [TaxId:5693]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96507 (0-End)
      • conflict (81)
      • conflict (103)
    Domains in SCOPe 2.06: d2j1qa1, d2j1qa2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j1qA (A:)
    masaevvskleaafaklqnasdchsllkkyltkevfdqlkgkqtkmgatlmdviqsgven
    ldsgigvyapdaesytlfaalldpiiedyhkgfkpsdkqppkdsgdlntfidvdpdkkyv
    istrvrcgrslegypfnpclkkqqyeemesrvkgqlesmsgelrgkyypltgmtketqkq
    liddhflfkegdrflqaahackfwptgrgiyhndaktflvwvneedhlriismqkggnlk
    evfgrlvtavgvieekvkfsrddrlgfltfcptnlgttirasvhiklpklgadrkkleev
    aakynlqvrgtagehsdspdgvydisnkrrlglseyeavkemqdgilelikaeesar
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1qA (A:)
    masaevvskleaafaklqnasdchsllkkyltkevfdqlkgkqtkmgatlmdviqsgven
    ldsgigvyapdaesytlfaalldpiiedyhkgfkpsdkqppkdsgdlntfidvdpdkkyv
    istrvrcgrslegypfnpclkkqqyeemesrvkgqlesmsgelrgkyypltgmtketqkq
    liddhflfkegdrflqaahackfwptgrgiyhndaktflvwvneedhlriismqkggnlk
    evfgrlvtavgvieekvkfsrddrlgfltfcptnlgttirasvhiklprkkleevaakyn
    lqvrgvydisnkrrlglseyeavkemqdgilelikaees