PDB entry 2j1l

View 2j1l on RCSB PDB site
Description: crystal structure of human rho-related GTP-binding protein rhod
Class: hydrolase
Keywords: gtpase, membrane, GTP-binding, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome dynamics
Deposited on 2006-08-14, released 2006-09-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rho-related GTP-binding protein rhod
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j1la_
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j1lA (A:)
    mhhhhhhssgvdlgtenlyfqsmageeappgvrsvkvvlvgdggcgktsllmvfadgafp
    esytptvferymvnlqvkgkpvhlhiwdtagqddydrlrplfypdasvlllcfdvtspns
    fdnifnrwypevnhfckkvpiivvgcktdlrkdkslvnklrrnglepvtyhrgqemarsv
    gavaylecsarlhdnvhavfqeaaevalssrgrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1lA (A:)
    vrsvkvvlvgdggcgktsllmvfadtptvferymvnlqvkgkpvhlhiwdtdasvlllcf
    dvtspnsfdnifnrwypevnhfckkvpiivvgcktdlrkdkslvnklrrnglepvtyhrg
    qemarsvgavaylecsarlhdnvhavfqeaaevalss