PDB entry 2j18

View 2j18 on RCSB PDB site
Description: chloroperoxidase mixture of ferric and ferrous states (low dose data set)
Class: oxidoreductase
Keywords: oxidoreductase, pyrrolidone carboxylic acid, glycoprotein, metal-binding, iron, heme, chloride, manganese, peroxidase
Deposited on 2006-08-09, released 2006-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.175
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloroperoxidase
    Species: CALDARIOMYCES FUMAGO [TaxId:5474]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J18 (0-0)
    • Uniprot P04963 (1-298)
    Domains in SCOPe 2.07: d2j18a1, d2j18a2
  • Heterogens: MN, HEM, NAG, MAN, BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j18A (A:)
    eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln
    hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva
    nsndfidnrnfdaetfqtsldvvagkthfdyadmneirlqreslsneldfpgwfteskpi
    qnvesgfifalvsdfnlpdndenplvridwwkywftnesfpyhlgwhppspareiefvts
    assavlaasvtstpsslpsgaigpgaeavplsfastmtpfllatnapyyaqdptlgpnd