PDB entry 2j0z

View 2j0z on RCSB PDB site
Description: p53 tetramerization domain wild type
Class: transcription
Keywords: p53, zinc, activator, apoptosis, wild type, cell cycle, acetylation, DNA-binding, polymorphism, tetramerization domain, transcription regulation, anti-oncogene, nuclear protein, phosphorylation, li-fraumeni syndrome, host-virus interaction, disease mutation, alternative splicing, glycoprotein, transcription, metal-binding
Deposited on 2006-08-08, released 2007-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j0za1
  • Chain 'B':
    Compound: Cellular tumor antigen p53
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j0zb1
  • Chain 'C':
    Compound: Cellular tumor antigen p53
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j0zc1
  • Chain 'D':
    Compound: Cellular tumor antigen p53
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2j0zd1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j0zA (A:)
    eyftlqirgrerfemfrelnealelkdaqag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j0zB (B:)
    eyftlqirgrerfemfrelnealelkdaqag
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j0zC (C:)
    eyftlqirgrerfemfrelnealelkdaqag
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j0zD (D:)
    eyftlqirgrerfemfrelnealelkdaqag