PDB entry 2j0z
View 2j0z on RCSB PDB site
Description: p53 tetramerization domain wild type
Class: transcription
Keywords: p53, zinc, activator, apoptosis, wild type, cell cycle, acetylation, DNA-binding, polymorphism, tetramerization domain, transcription regulation, anti-oncogene, nuclear protein, phosphorylation, li-fraumeni syndrome, host-virus interaction, disease mutation, alternative splicing, glycoprotein, transcription, metal-binding
Deposited on
2006-08-08, released
2007-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-04-25, with a file datestamp of
2018-04-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Cellular tumor antigen p53
Species: HOMO SAPIENS, synthetic [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2j0za1 - Chain 'B':
Compound: Cellular tumor antigen p53
Species: HOMO SAPIENS, synthetic [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2j0zb1 - Chain 'C':
Compound: Cellular tumor antigen p53
Species: HOMO SAPIENS, synthetic [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2j0zc1 - Chain 'D':
Compound: Cellular tumor antigen p53
Species: HOMO SAPIENS, synthetic [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2j0zd1
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2j0zA (A:)
eyftlqirgrerfemfrelnealelkdaqag
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2j0zB (B:)
eyftlqirgrerfemfrelnealelkdaqag
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2j0zC (C:)
eyftlqirgrerfemfrelnealelkdaqag
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>2j0zD (D:)
eyftlqirgrerfemfrelnealelkdaqag