PDB entry 2j0t

View 2j0t on RCSB PDB site
Description: crystal structure of the catalytic domain of mmp-1 in complex with the inhibitory domain of timp-1
Class: hydrolase
Keywords: extracellular matrix, erythrocyte maturation, autocatalytic cleavage, collagen degradation, hydrolase,, hydrolase
Deposited on 2006-08-04, released 2006-10-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.249
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interstitial collagenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2j0ta_
  • Chain 'B':
    Compound: interstitial collagenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2j0tb_
  • Chain 'C':
    Compound: interstitial collagenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2j0tc_
  • Chain 'D':
    Compound: Metalloproteinase inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2j0td_
  • Chain 'E':
    Compound: Metalloproteinase inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2j0te_
  • Chain 'F':
    Compound: Metalloproteinase inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2j0tf_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j0tA (A:)
    mvltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadi
    misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahe
    lghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0tA (A:)
    gnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfv
    rgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghsl
    glshstdigalmypsytfsgdvqlaqddidgiqaiygrsqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j0tB (B:)
    mvltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadi
    misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahe
    lghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0tB (B:)
    gnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfv
    rgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghsl
    glshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j0tC (C:)
    mvltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadi
    misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahe
    lghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0tC (C:)
    gnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfv
    rgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghsl
    glshstdigalmypsytfsgdvqlaqddidgiqaiygrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j0tD (D:)
    ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgcee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0tD (D:)
    ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j0tE (E:)
    ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgcee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0tE (E:)
    ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2j0tF (F:)
    ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgcee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0tF (F:)
    ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgc