PDB entry 2j0t

View 2j0t on RCSB PDB site
Description: crystal structure of the catalytic domain of mmp-1 in complex with the inhibitory domain of timp-1
Class: hydrolase
Keywords: extracellular matrix, erythrocyte maturation, metalloprotease, collagen degradation, zinc, calcium, ob fold, zymogen, protease, hydrolase, metalloenzyme inhibitor, metalloprotease inhibitor, matrix metalloprotease, autocatalytic cleavage, collagenase, polymorphism, glycoprotein, metal-binding, tissue inhibitor of metalloproteinase
Deposited on 2006-08-04, released 2006-10-18
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.249
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interstitial collagenase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j0ta1
  • Chain 'B':
    Compound: interstitial collagenase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j0tb1
  • Chain 'C':
    Compound: interstitial collagenase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j0tc1
  • Chain 'D':
    Compound: Metalloproteinase inhibitor 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j0td1
  • Chain 'E':
    Compound: Metalloproteinase inhibitor 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j0te1
  • Chain 'F':
    Compound: Metalloproteinase inhibitor 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j0tf1
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j0tA (A:)
    mvltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadi
    misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahe
    lghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0tA (A:)
    gnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfv
    rgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghsl
    glshstdigalmypsytfsgdvqlaqddidgiqaiygrsqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j0tB (B:)
    mvltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadi
    misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahe
    lghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0tB (B:)
    gnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfv
    rgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghsl
    glshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j0tC (C:)
    mvltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadi
    misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahe
    lghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0tC (C:)
    gnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadimisfv
    rgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaahelghsl
    glshstdigalmypsytfsgdvqlaqddidgiqaiygrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j0tD (D:)
    ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgcee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0tD (D:)
    ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgc
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2j0tE (E:)
    ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgcee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0tE (E:)
    ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2j0tF (F:)
    ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgcee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0tF (F:)
    ctcvpphpqtafcnsdlvirakfvgtpevnqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrshnrseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgc