PDB entry 2j0s

View 2j0s on RCSB PDB site
Description: the crystal structure of the exon junction complex at 2.2 a resolution
Class: hydrolase
Keywords: mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport, nuclear protein, alternative splicing, nonsense-mediated mRNA decay, dead-box helicase, nucleotide-binding, ATP-binding, DNA-binding, RNA-binding, coiled coil, ejc, helicase, hydrolase, transport, acetylation
Deposited on 2006-08-04, released 2006-09-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.187
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase ddx48
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2j0sa1, d2j0sa2
  • Chain 'C':
    Compound: Protein mago nashi homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2j0sc_
  • Chain 'D':
    Compound: RNA-binding protein 8A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2j0sd_
  • Chain 'E':
    Compound: 5'-r(*up*up*up*up*up*up*up*up*up*up *up*up*up*up*u)-3'
  • Chain 'T':
    Compound: Protein CASC3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j0sA (A:)
    attatmatsgsarkrllkeedmtkvefetseevdvtptfdtmglredllrgiyaygfekp
    saiqqraikqiikgrdviaqsqsgtgktatfsisvlqcldiqvretqalilaptrelavq
    iqkgllalgdymnvqchaciggtnvgedirkldygqhvvagtpgrvfdmirrrslrtrai
    kmlvldeademlnkgfkeqiydvyrylppatqvvlisatlpheilemtnkfmtdpirilv
    krdeltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmrean
    ftvssmhgdmpqkeresimkefrsgasrvlistdvwargldvpqvsliinydlpnnrely
    ihrigrsgrygrkgvainfvknddirilrdieqyystqidempmnvadli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0sA (A:)
    edmtkvefetseevdvtptfdtmglredllrgiyaygfekpsaiqqraikqiikgrdvia
    qsqsgtgktatfsisvlqcldiqvretqalilaptrelavqiqkgllalgdymnvqchac
    iggtnvgedirkldygqhvvagtpgrvfdmirrrslrtraikmlvldeademlnkgfkeq
    iydvyrylppatqvvlisatlpheilemtnkfmtdpirilvkrdeltlegikqffvaver
    eewkfdtlcdlydtltitqavifcntkrkvdwltekmreanftvssmhgdmpqkeresim
    kefrsgasrvlistdvwargldvpqvsliinydlpnnrelyihrigrsgrygrkgvainf
    vknddirilrdieqyystqidempmnvadli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j0sC (C:)
    mesdfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeel
    kriiddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglr
    vfyylvqdlkclvfsliglhfkikpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0sC (C:)
    dfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkri
    iddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvfy
    ylvqdlkclvfsliglhfkikpi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2j0sD (D:)
    pqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyetyk
    eaqaameglngqdlmgqpisvdwcfvrgp
    

  • Chain 'E':
    No sequence available.

  • Chain 'T':
    No sequence available.