PDB entry 2j0q

View 2j0q on RCSB PDB site
Description: the crystal structure of the exon junction complex at 3.2 a resolution
Class: hydrolase
Keywords: hydrolase, mRNA processing, mRNA splicing, mRNA transport, nuclear protein, dead-box helicase, RNA-binding
Deposited on 2006-08-04, released 2006-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.235
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase ddx48
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j0qa1, d2j0qa2
  • Chain 'B':
    Compound: ATP-dependent RNA helicase ddx48
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j0qb1, d2j0qb2
  • Chain 'C':
    Compound: Protein mago nashi homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j0qc1
  • Chain 'D':
    Compound: RNA-binding protein 8A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j0qd1
  • Chain 'E':
    Compound: 5'-r(*up*up*up*up*up*up*up*up*up*up*up*up*up*up*u)-3'
  • Chain 'F':
    Compound: Protein mago nashi homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j0qf1
  • Chain 'G':
    Compound: RNA-binding protein 8A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j0qg1
  • Chain 'H':
    Compound: 5'-r(*up*up*up*up*up*up*up*up*up*up*up*up*up*up*u)-3'
  • Chain 'I':
    Compound: Protein CASC3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'T':
    Compound: Protein CASC3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j0qA (A:)
    attatmatsgsarkrllkeedmtkvefetseevdvtptfdtmglredllrgiyaygfekp
    saiqqraikqiikgrdviaqsqsgtgktatfsisvlqcldiqvretqalilaptrelavq
    iqkgllalgdymnvqchaciggtnvgedirkldygqhvvagtpgrvfdmirrrslrtrai
    kmlvldeademlnkgfkeqiydvyrylppatqvvlisatlpheilemtnkfmtdpirilv
    krdeltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmrean
    ftvssmhgdmpqkeresimkefrsgasrvlistdvwargldvpqvsliinydlpnnrely
    ihrigrsgrygrkgvainfvknddirilrdieqyystqidempmnvadli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0qA (A:)
    dmtkvefetseevdvtptfdtmglredllrgiyaygfekpsaiqqraikqiikgrdviaq
    sqsgtgktatfsisvlqcldiqvretqalilaptrelavqiqkgllalgdymnvqchaci
    ggtnvgedirkldygqhvvagtpgrvfdmirrrslrtraikmlvldeademlnkgfkeqi
    ydvyrylppatqvvlisatlpheilemtnkfmtdpirilvkrdeltlegikqffvavere
    ewkfdtlcdlydtltitqavifcntkrkvdwltekmreanftvssmhgdmpqkeresimk
    efrsgasrvlistdvwargldvpqvsliinydlpnnrelyihrigrsgrygrkgvainfv
    knddirilrdieqyystqidempmnvadli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j0qB (B:)
    attatmatsgsarkrllkeedmtkvefetseevdvtptfdtmglredllrgiyaygfekp
    saiqqraikqiikgrdviaqsqsgtgktatfsisvlqcldiqvretqalilaptrelavq
    iqkgllalgdymnvqchaciggtnvgedirkldygqhvvagtpgrvfdmirrrslrtrai
    kmlvldeademlnkgfkeqiydvyrylppatqvvlisatlpheilemtnkfmtdpirilv
    krdeltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmrean
    ftvssmhgdmpqkeresimkefrsgasrvlistdvwargldvpqvsliinydlpnnrely
    ihrigrsgrygrkgvainfvknddirilrdieqyystqidempmnvadli
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0qB (B:)
    dmtkvefetseevdvtptfdtmglredllrgiyaygfekpsaiqqraikqiikgrdviaq
    sqsgtgktatfsisvlqcldiqvretqalilaptrelavqiqkgllalgdymnvqchaci
    ggtnvgedirkldygqhvvagtpgrvfdmirrrslrtraikmlvldeademlnkgfkeqi
    ydvyrylppatqvvlisatlpheilemtnkfmtdpirilvkrdeltlegikqffvavere
    ewkfdtlcdlydtltitqavifcntkrkvdwltekmreanftvssmhgdmpqkeresimk
    efrsgasrvlistdvwargldvpqvsliinydlpnnrelyihrigrsgrygrkgvainfv
    knddirilrdieqyystqidempmnvadli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2j0qC (C:)
    mesdfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeel
    kriiddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglr
    vfyylvqdlkclvfsliglhfkikpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0qC (C:)
    dfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkri
    iddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvfy
    ylvqdlkclvfsliglhfkikpi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2j0qD (D:)
    pqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyetyk
    eaqaameglngqdlmgqpisvdwcfvrgppkgkrrggrrrsrspdrrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0qD (D:)
    pqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyetyk
    eaqaameglngqdlmgqpisvdwcfvrgp
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2j0qF (F:)
    mesdfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeel
    kriiddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglr
    vfyylvqdlkclvfsliglhfkikpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0qF (F:)
    dfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelkri
    iddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrvfy
    ylvqdlkclvfsliglhfkikpi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2j0qG (G:)
    pqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyetyk
    eaqaameglngqdlmgqpisvdwcfvrgppkgkrrggrrrsrspdrrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0qG (G:)
    pqrsvegwilfvtgvheeateedihdkfaeygeiknihlnldrrtgylkgytlveyetyk
    eaqaameglngqdlmgqpisvdwcfvrgp
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'T':
    No sequence available.