PDB entry 2j0m

View 2j0m on RCSB PDB site
Description: crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.
Class: transferase
Keywords: focal adhesion, cell migration, phosphorylation, ferm, kinase, transferase, ATP-binding, integrin signaling, nucleotide-binding, tyrosine-protein kinase
Deposited on 2006-08-03, released 2007-07-03
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J0M
    • Uniprot Q00944 (2-End)
    Domains in SCOPe 2.01: d2j0ma1, d2j0ma2, d2j0ma3
  • Chain 'B':
    Compound: Focal adhesion kinase 1
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00944 (Start-275)
      • conflict (38)
      • conflict (105)
      • conflict (145-146)
    Domains in SCOPe 2.01: d2j0mb_
  • Heterogens: 4ST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j0mA (A:)
    gsgamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrls
    hlqseevhwlhldmgvsnvrekfelahppeewkyelrirylpkgflnqftedkptlnffy
    qqvkndymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglrrffp
    kslldsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswii
    svelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrkgmlqlkiagapeplt
    vtapsltiaenmadlidgycrlvngatqsfiirpqkegeralpsipklannekqgvrsht
    vsvsetddyae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0mA (A:)
    gamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshl
    qseevhwlhldmgvsnvrekfelahppeewkyelrirylpkgflnqftedkptlnffyqq
    vkndymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglrrffpks
    lldsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiisv
    elaigpeegisyltdkganpthladfnqvqtiqysnsedkdrkgmlqlkiagapepltvt
    apsltiaenmadlidgycrlvngatqsfi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j0mB (B:)
    strdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflq
    ealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayql
    stalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwma
    pesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncppt
    lyslmtkcwaydpsrrprftelkaqlstileeeklq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0mB (B:)
    dyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqeal
    tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlsta
    layleskrfvhrdiaarnvlvssndcvklgdfgllpikwmapesinfrrftsasdvwmfg
    vcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrprf
    telkaqlstileeeklq