PDB entry 2j0m

View 2j0m on RCSB PDB site
Description: crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.
Class: transferase
Keywords: focal adhesion, cell migration, phosphorylation, ferm, kinase, transferase, ATP-binding, integrin signaling, nucleotide-binding, tyrosine-protein kinase
Deposited on 2006-08-03, released 2007-07-03
The last revision prior to the SCOP 1.75 freeze date was dated 2007-07-03, with a file datestamp of 2007-06-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2j0ma1, d2j0ma2, d2j0ma3
  • Chain 'B':
    Compound: Focal adhesion kinase 1
    Species: GALLUS GALLUS
  • Heterogens: 4ST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j0mA (A:)
    gsgamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrls
    hlqseevhwlhldmgvsnvrekfelahppeewkyelrirylpkgflnqftedkptlnffy
    qqvkndymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglrrffp
    kslldsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswii
    svelaigpeegisyltdkganpthladfnqvqtiqysnsedkdrkgmlqlkiagapeplt
    vtapsltiaenmadlidgycrlvngatqsfiirpqkegeralpsipklannekqgvrsht
    vsvsetddyae
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0mA (A:)
    gamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshl
    qseevhwlhldmgvsnvrekfelahppeewkyelrirylpkgflnqftedkptlnffyqq
    vkndymleiadqvdqeialklgcleirrsygemrgnalekksnyevlekdvglrrffpks
    lldsvkaktlrkliqqtfrqfanlnreesilkffeilspvyrfdkecfkcalgsswiisv
    elaigpeegisyltdkganpthladfnqvqtiqysnsedkdrkgmlqlkiagapepltvt
    apsltiaenmadlidgycrlvngatqsfi
    

  • Chain 'B':
    No sequence available.