PDB entry 2j0l

View 2j0l on RCSB PDB site
Description: crystal structure of a the active conformation of the kinase domain of focal adhesion kinase with a phosphorylated activation loop.
Class: transferase
Keywords: focal adhesion, cell migration, phosphorylation, ferm, kinase, transferase, ATP-binding, integrin signaling, nucleotide-binding, tyrosine-protein kinase
Deposited on 2006-08-03, released 2007-06-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Focal adhesion kinase 1
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00944 (0-275)
    • conflict (145-146)
  Domains in SCOPe 2.06: d2j0la_
• Heterogens: SO4, MG, ANP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2j0lA (A:)
  strdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflq
  ealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayql
  stalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwma
  pesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncppt
  lyslmtkcwaydpsrrprftelkaqlstileeeklq