PDB entry 2j0i

View 2j0i on RCSB PDB site
Description: crystal structure of the human p21-activated kinase 4
Class: transferase
Keywords: protein kinase, phosphorylation, nucleotide-binding, pak4, ste20, kinase, transferase, ATP-binding, alternative splicing, serine/threonine-protein kinase
Deposited on 2006-08-03, released 2006-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.174
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase pak 4
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2j0ia_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j0iA (A:)
    gsspqrepqrvsheqfraalqlvvdpgdprsyldnfikigegstgivciatvrssgklva
    vkkmdlrkqqrrellfnevvimrdyqhenvvemynsylvgdelwvvmefleggaltdivt
    htrmneeqiaavclavlqalsvlhaqgvihrdiksdsillthdgrvklsdfgfcaqvske
    vprrkslvgtpywmapelisrlpygpevdiwslgimviemvdgeppyfnepplkamkmir
    dnlpprlknlhkvspslkgfldrllvrdpaqrataaellkhpflakagppasivplmrqn
    rtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0iA (A:)
    sheqfraalqlvvdpgdprsyldnfikigegstgivciatvrssgklvavkkmdlrkqqr
    rellfnevvimrdyqhenvvemynsylvgdelwvvmefleggaltdivthtrmneeqiaa
    vclavlqalsvlhaqgvihrdiksdsillthdgrvklsdfgfcaqvskevprrkslvgtp
    ywmapelisrlpygpevdiwslgimviemvdgeppyfnepplkamkmirdnlpprlknlh
    kvspslkgfldrllvrdpaqrataaellkhpflakagppasivplmrqnr