PDB entry 2j0d

View 2j0d on RCSB PDB site
Description: crystal structure of human p450 3a4 in complex with erythromycin
Class: oxidoreductase
Keywords: polymorphism, erythromycin, monooxygenase, metal-binding, transmembrane, oxidoreductase, endoplasmic reticulum, drug metabolizing enzyme, p450, nadp, iron, heme, cyp3a4, membrane, microsome
Deposited on 2006-08-02, released 2006-09-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.242
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J0D
      • conflict (369)
    • Uniprot P08684
    Domains in SCOPe 2.07: d2j0da1
  • Chain 'B':
    Compound: cytochrome p450 3a4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J0D
      • conflict (369)
    • Uniprot P08684
    Domains in SCOPe 2.07: d2j0db1
  • Heterogens: HEM, ERY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j0dA (A:)
    maygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvl
    aitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgkl
    kemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdp
    fventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrle
    dtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyela
    thpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdve
    ingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtvsg
    ahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0dA (A:)
    shglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdpd
    miktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvpi
    iaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidsnpqdpfventkkl
    lrffflsitvfpflipilevlnicvfprevtnflrksvkrmkesrflqlmidsqnshkal
    sdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavlpnkapptydtv
    lqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsyalhrdpkywte
    pekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirvlqnfsfkpcke
    tqiplklslggllqpekpvvlkvesr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j0dB (B:)
    maygthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvl
    aitdpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgkl
    kemvpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdp
    fventkkllrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrle
    dtqkhrvdflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyela
    thpdvqqklqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdve
    ingmfipkgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprnc
    igmrfalmnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdgtvsg
    ahhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j0dB (B:)
    gthshglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlait
    dpdmiktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkem
    vpiiaqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidsnpqdpfvent
    kklpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrflqlmidsqhkals
    dlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavlpnkapptydtvl
    qmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsyalhrdpkywtep
    ekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirvlqnfsfkpcket
    qiplklslggllqpekpvvlkvesr