PDB entry 2j09

View 2j09 on RCSB PDB site
Description: thermus DNA photolyase with fmn antenna chromophore
Class: lyase
Keywords: lyase, flavoprotein, DNA repair,
Deposited on 2006-08-01, released 2007-05-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribodipyrimidine photo-lyase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2j09a1, d2j09a2
  • Heterogens: CL, FAD, FMN, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j09A (A:)
    mgpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralrea
    yrarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllp
    aphllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpglplpepgee
    aalaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweaerrggegark
    wvaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktgvplvdaamr
    elhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgwqwagglgvd
    aapyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrrylrlardlarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j09A (A:)
    gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay
    rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa
    phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpglplpepgeea
    alaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweaerrggegarkw
    vaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktgvplvdaamre
    lhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgwqwagglgvda
    apyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrrylrlardlarg