PDB entry 2j08

View 2j08 on RCSB PDB site
Description: thermus DNA photolyase with 8-iod-riboflavin antenna chromophore
Class: lyase
Keywords: chromophore, DNA binding protein, flavoprotein, fad, lyase, 8-irf, plasmid, DNA damage, DNA repair, nucleotide-binding, antenna chromophore, photoreactivating enzyme, cyclobutane pyrimidine dimer (cpd)
Deposited on 2006-08-01, released 2007-05-01
The last revision prior to the SCOP 1.73 freeze date was dated 2007-05-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.167
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribodipyrimidine photo-lyase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2j08a1, d2j08a2
  • Heterogens: CL, PO4, FAD, IRF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j08A (A:)
    mgpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralrea
    yrarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllp
    aphllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpglplpepgee
    aalaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweaerrggegark
    wvaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktgvplvdaamr
    elhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgwqwagglgvd
    aapyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrrylrlardlarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j08A (A:)
    gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay
    rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa
    phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpglplpepgeea
    alaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweaerrggegarkw
    vaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktgvplvdaamre
    lhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgwqwagglgvda
    apyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrrylrlardlarg