PDB entry 2j07

View 2j07 on RCSB PDB site
Description: thermus DNA photolyase with 8-hdf antenna chromophore
Class: lyase
Keywords: lyase, flavoprotein, nucleotide-binding, DNA repair
Deposited on 2006-08-01, released 2007-05-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.171
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyribodipyrimidine photo-lyase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2j07a1, d2j07a2
  • Heterogens: FAD, HDF, CL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2j07A (A:)
    mgpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralrea
    yrarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllp
    aphllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpglplpepgee
    aalaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweaerrggegark
    wvaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktgvplvdaamr
    elhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgwqwagglgvd
    aapyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrrylrlardlarg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j07A (A:)
    gpllvwhrgdlrlhdhpallealargpvvglvvldpnnlkttprrrawflenvralreay
    rarggalwvleglpwekvpeaarrlkakavyaltshtpygryrdgrvrealpvplhllpa
    phllppdlprayrvytpfsrlyrgaapplpppealpkgpeegeipredpglplpepgeea
    alaglrafleaklpryaeerdrldgeggsrlspyfalgvlsprlaaweaerrggegarkw
    vaellwrdfsyhllyhfpwmaerpldprfqafpwqedealfqawyegktgvplvdaamre
    lhatgflsnrarmnaaqfavkhlllpwkrceeafrhllldgdravnlqgwqwagglgvda
    apyfrvfnpvlqgerhdpegrwlkrwapeypsyapkdpvvdleearrrylrlardlarg