PDB entry 2j01
View 2j01 on RCSB PDB site
Description: structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 2 of 4). this file contains the 50s subunit from molecule I.
Class: ribosome
Keywords: ribosome, tRNA, paromomycin, mRNA, translation
Deposited on
2006-07-31, released
2006-09-28
The last revision prior to the SCOP 1.73 freeze date was dated
2006-10-04, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.272
AEROSPACI score: 0.09
(click here for full SPACI score report)
Chains and heterogens:
- Chain '0':
Compound: 50S ribosomal protein L27
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- PDB 2J01 (0-0)
- Uniprot P60493 (1-84)
- Chain '1':
Compound: 50S ribosomal protein L28
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2j0111 - Chain '2':
Compound: 50S ribosomal protein L29
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2j0121 - Chain '3':
Compound: 50S ribosomal protein L30
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain '4':
Compound: 50S ribosomal protein L31
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain '5':
Compound: 50S ribosomal protein L32
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain '6':
Compound: 50S ribosomal protein L33
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain '7':
Compound: 50S ribosomal protein L34
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain '8':
Compound: 50S ribosomal protein L35
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'A':
Compound: 23S ribosomal RNA
Species: Thermus thermophilus
- Chain 'B':
Compound: 5S ribosomal RNA
Species: Thermus thermophilus
- Chain 'C':
Compound: 50s ribosomal protein l1
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2j01c1 - Chain 'D':
Compound: 50S ribosomal protein L2
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: 50S ribosomal protein L3
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: 50S ribosomal protein L4
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'G':
Compound: 50S ribosomal protein L5
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'H':
Compound: 50S ribosomal protein L6
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'I':
Compound: 50S ribosomal protein L9
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2j01i1, d2j01i2 - Chain 'N':
Compound: 50S ribosomal protein L13
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'O':
Compound: 50S ribosomal protein L14
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2j01o1 - Chain 'P':
Compound: 50S ribosomal protein L15
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'Q':
Compound: 50S ribosomal protein L16
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'R':
Compound: 50S ribosomal protein L17
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'S':
Compound: 50S ribosomal protein L18
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'T':
Compound: 50S ribosomal protein L19
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'U':
Compound: 50S ribosomal protein L20
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'V':
Compound: 50S ribosomal protein L21
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'W':
Compound: 50S ribosomal protein L22
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'X':
Compound: 50s ribosomal protein l10
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'Y':
Compound: 50S ribosomal protein L11
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
- Chain 'Z':
Compound: 50s ribosomal protein l7
Species: Thermus thermophilus
Database cross-references and differences (RAF-indexed):
PDB Chain Sequences:
- Chain '0':
No sequence available.
- Chain '1':
Sequence, based on SEQRES records: (download)
>2j011 (1:)
mskvceisgkrpivansiqrrgkakreggvgkkttgiskrrqypnlqkvrvrvagqeitf
rvaashipkvyelverakglkleglspkeikkellkll
Sequence, based on observed residues (ATOM records): (download)
>2j011 (1:)
sgkrpivansiqrrgkakreggvgkkttgiskrrqypnlqkvrvrvagqeitfrvaashi
pkvyelverakglkleglspkeikkellk
- Chain '2':
Sequence, based on SEQRES records: (download)
>2j012 (2:)
mklsevrkqleearklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarl
ltvlnekrrqna
Sequence, based on observed residues (ATOM records): (download)
>2j012 (2:)
earklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarllt
- Chain '3':
No sequence available.
- Chain '4':
No sequence available.
- Chain '5':
No sequence available.
- Chain '6':
No sequence available.
- Chain '7':
No sequence available.
- Chain '8':
No sequence available.
- Chain 'A':
No sequence available.
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2j01C (C:)
mpkhgkryrallekvdpnkvytideaarlvkelatakfdetvevhaklgidprrsdqnvr
gtvslphglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdv
mgavgsklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkas
fppekladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
Sequence, based on observed residues (ATOM records): (download)
>2j01C (C:)
kvytideaartakfdetvevhaklgidprrsdqnvrgtvslphglgkqvrvlaiakgeki
keaeeagadyvggeeiiqkildgwmdfvmgavgsklgrilgprglnpkagtvgfnigeii
reikagriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvy
vtttmgpsvri
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.
- Chain 'H':
No sequence available.
- Chain 'I':
Sequence, based on SEQRES records: (download)
>2j01I (I:)
mkvilleplenlgdvgqvvdvkpgyarnyllprglavlatesnlkaleariraqakrlae
rkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrlalekpi
kelgeyvltykphpevpiqlkvsvvaqe
Sequence, based on observed residues (ATOM records): (download)
>2j01I (I:)
mkvilleplenlgdvgqvvdvkpgyarnyllprglavlatesnlkaleariraqakrlae
rkaeaerlkeilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrlalekpi
kelgeyvltykphpevpiqlkvsvvv
- Chain 'N':
No sequence available.
- Chain 'O':
Sequence; same for both SEQRES and ATOM records: (download)
>2j01O (O:)
miqpqtylevadntgarkimcirvlkgsnakyatvgdvivasvkeaiprgavkegdvvka
vvvrtkkeikrpdgsairfddnaaviinnqleprgtrvfgpvarelrekgfmkivslape
vl
- Chain 'P':
No sequence available.
- Chain 'Q':
No sequence available.
- Chain 'R':
No sequence available.
- Chain 'S':
No sequence available.
- Chain 'T':
No sequence available.
- Chain 'U':
No sequence available.
- Chain 'V':
No sequence available.
- Chain 'W':
No sequence available.
- Chain 'X':
No sequence available.
- Chain 'Y':
No sequence available.
- Chain 'Z':
No sequence available.