PDB entry 2izz

View 2izz on RCSB PDB site
Description: crystal structure of human pyrroline-5-carboxylate reductase
Class: oxidoreductase
Keywords: amino-acid biosynthesis, nadp, oxidoreductase, proline biosynthesis
Deposited on 2006-07-31, released 2006-08-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.167
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZZ (Start-21)
    • Uniprot P32322 (22-End)
    Domains in SCOPe 2.05: d2izza1, d2izza2
  • Chain 'B':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZZ (Start-21)
    • Uniprot P32322 (22-End)
    Domains in SCOPe 2.05: d2izzb1, d2izzb2
  • Chain 'C':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZZ (Start-21)
    • Uniprot P32322 (22-End)
    Domains in SCOPe 2.05: d2izzc1, d2izzc2
  • Chain 'D':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZZ (Start-21)
    • Uniprot P32322 (22-End)
    Domains in SCOPe 2.05: d2izzd1, d2izzd2
  • Chain 'E':
    Compound: Pyrroline-5-carboxylate reductase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZZ
    • Uniprot P32322 (22-End)
    Domains in SCOPe 2.05: d2izze1, d2izze2
  • Heterogens: NAD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2izzA (A:)
    mhhhhhhssgvdlgtenlyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmd
    latvsalrkmgvkltphnketvqhsdvlflavkphiipfildeigadiedrhivvscaag
    vtissiekklsafrpaprvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgf
    cteveedlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmll
    hseqhpgqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqeqvs
    paaikktildkvkldspagtal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izzA (A:)
    smsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnket
    vqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvir
    cmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgpa
    yaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggati
    halhvlesggfrsllinaveascirtrelqsm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2izzB (B:)
    mhhhhhhssgvdlgtenlyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmd
    latvsalrkmgvkltphnketvqhsdvlflavkphiipfildeigadiedrhivvscaag
    vtissiekklsafrpaprvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgf
    cteveedlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmll
    hseqhpgqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqeqvs
    paaikktildkvkldspagtal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izzB (B:)
    nlyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltp
    hnketvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpa
    prvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtgls
    gsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvssp
    ggatihalhvlesggfrsllinaveascirtrelqsmad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2izzC (C:)
    mhhhhhhssgvdlgtenlyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmd
    latvsalrkmgvkltphnketvqhsdvlflavkphiipfildeigadiedrhivvscaag
    vtissiekklsafrpaprvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgf
    cteveedlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmll
    hseqhpgqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqeqvs
    paaikktildkvkldspagtal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izzC (C:)
    smsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnket
    vqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvir
    cmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgpa
    yaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggati
    halhvlesggfrsllinaveascirtrelqsmadqe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2izzD (D:)
    mhhhhhhssgvdlgtenlyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmd
    latvsalrkmgvkltphnketvqhsdvlflavkphiipfildeigadiedrhivvscaag
    vtissiekklsafrpaprvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgf
    cteveedlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmll
    hseqhpgqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqeqvs
    paaikktildkvkldspagtal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izzD (D:)
    lyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltph
    nketvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpap
    rvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsg
    sgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspg
    gatihalhvlesggfrsllinaveascirtrelqsm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2izzE (E:)
    mhhhhhhssgvdlgtenlyfqsmsvgfigagqlafalakgftaagvlaahkimasspdmd
    latvsalrkmgvkltphnketvqhsdvlflavkphiipfildeigadiedrhivvscaag
    vtissiekklsafrpaprvircmtntpvvvregatvyatgthaqvedgrlmeqllssvgf
    cteveedlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmll
    hseqhpgqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqeqvs
    paaikktildkvkldspagtal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izzE (E:)
    msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv
    qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc
    mtntpvvvregatvyatgthaqvedgrlmeqllssvgfcteveedlidavtglsgsgpay
    aftaldaladggvkmglprrlavrlgaqallgaakmllhseqhpgqlkdnvsspggatih
    alhvlesggfrsllinaveascirtrelqsma