PDB entry 2izx

View 2izx on RCSB PDB site
Description: Molecular Basis of AKAP Specificity for PKA Regulatory Subunits
Class: transferase
Keywords: camp-binding, phosphorylation, nucleotide-binding, pka, camp, akap, anchor, kinase, transferase
Deposited on 2006-07-27, released 2006-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13861 (Start-40)
  Domains in SCOPe 2.08: d2izxa_
• Chain 'B':
  Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13861 (0-40)
  Domains in SCOPe 2.08: d2izxb_
• Chain 'C':
  Compound: akap-is
  Species: synthetic construct, synthetic [TaxId:32630]
  Database cross-references and differences (RAF-indexed):
  • PDB 2IZX (0-17)
• Heterogens: DTD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2izxA (A:)
  iqippgltellqgytvevlrqqppdlvefaveyftrlrear
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2izxA (A:)
  ippgltellqgytvevlrqqppdlvefaveyftrlrear
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2izxB (B:)
  iqippgltellqgytvevlrqqppdlvefaveyftrlrear
  

  
  
• Chain 'C':
  No sequence available.