PDB entry 2izu

View 2izu on RCSB PDB site
Description: structure of casein kinase gamma 3 in complex with inhibitor
Class: transferase
Keywords: serine/threonine-protein kinase, kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding, wnt signaling pathway, serine/threonine kinase
Deposited on 2006-07-26, released 2006-08-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.157
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase I isoform gamma-3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2IZU
      • conflict (154)
    • Uniprot Q9Y6M4
    Domains in SCOPe 2.04: d2izua_
  • Heterogens: P01, EDO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2izuA (A:)
    smgvlmvgpnfrvgkkigcgnfgelrlgknlytneyvaiklepmksrapqlhleyrfykq
    lgsgdgipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmey
    vhsknliyrdvkpenfligrpgnktqqvihiidfalakeyidpetkkhipyrehksltgt
    arymsinthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratp
    ievlcenfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlpt
    pvgavqqdpalssnreahqhrdkmqqsknq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2izuA (A:)
    vlmvgpnfrvgkkigcfgelrlgknlytneyvaiklepmksrapqlhleyrfykqlgsgd
    gipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmeyvhskn
    liyrdvkpenfligrpgnktqqvihiidfalakeyidpetkkhipyrehksltgtaryms
    inthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratpievlc
    enfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlptpv