PDB entry 2izt

View 2izt on RCSB PDB site
Description: structure of casein kinase gamma 3 in complex with inhibitor
Class: transferase
Keywords: transferase, ransferase, nucleotide-binding, wnt signaling pathway
Deposited on 2006-07-26, released 2006-08-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase I isoform gamma-3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6M4
      • conflict (154)
    Domains in SCOPe 2.06: d2izta_
  • Heterogens: 23D, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iztA (A:)
    smgvlmvgpnfrvgkkigcgnfgelrlgknlytneyvaiklepmksrapqlhleyrfykq
    lgsgdgipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmey
    vhsknliyrdvkpenfligrpgnktqqvihiidfalakeyidpetkkhipyrehksltgt
    arymsinthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratp
    ievlcenfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlpt
    pvgavqqdpalssnreahqhrdkmqqsknq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iztA (A:)
    lmvgpnfrvgkkigcfgelrlgknlytneyvaiklepmksrapqlhleyrfykqlgsgdg
    ipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmeyvhsknl
    iyrdvkpenfligrpgnktqqvihiidfalakeyidpetkkhipyrehksltgtarymsi
    nthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratpievlce
    nfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlptpv