PDB entry 2izn

View 2izn on RCSB PDB site
Description: ms2-RNA hairpin (g-10) complex
Class: virus/RNA
Keywords: virus/RNA, 3d-structure, capsid, capsid protein, complex (capsid protein/RNA hairpin), hairpin, levivirus, RNA-binding, structural protein, virus/viral protein/RNA, virus
Deposited on 2006-07-25, released 2006-07-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.56 Å
R-factor: 0.197
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ms2 coat protein
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2izna_
  • Chain 'B':
    Compound: ms2 coat protein
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iznb_
  • Chain 'C':
    Compound: ms2 coat protein
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2iznc_
  • Chain 'R':
    Compound: 5'-r(*ap*cp*ap*up*cp*gp*cp*gp*ap*up *up*ap*cp*gp*gp*ap*up*gp*u)-3'
    Species: ENTEROBACTERIO PHAGE MS2, synthetic [TaxId:12022]
  • Chain 'S':
    Compound: 5'-r(*ap*cp*ap*up*cp*gp*cp*gp*ap*up *up*ap*cp*gp*gp*ap*up*gp*u)-3'
    Species: ENTEROBACTERIO PHAGE MS2, synthetic [TaxId:12022]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iznA (A:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iznB (B:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2iznC (C:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.