PDB entry 2izk

View 2izk on RCSB PDB site
Description: streptavidin-glycoluril ph 2.58 i4122 complex
Class: biotin-binding protein
Keywords: biotin-binding protein, streptavidin-small molecule ligand, designed small molecule ligand with micromolar affinity
Deposited on 1997-08-13, released 1998-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2izka_
  • Heterogens: ACT, SO4, GLL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2izkA (A:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkp