PDB entry 2izb

View 2izb on RCSB PDB site
Description: apostreptavidin ph 3.12 i4122 structure
Class: biotin-binding protein
Keywords: biotin-binding protein, apostreptavidin
Deposited on 1997-08-13, released 1998-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: streptavidin
  Species: Streptomyces avidinii [TaxId:1895]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22629 (0-121)
  Domains in SCOPe 2.08: d2izba_
• Heterogens: SO4, FMT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2izbA (A:)
  aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
  lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
  vk