PDB entry 2iz1

View 2iz1 on RCSB PDB site
Description: 6pdh complexed with pex inhibitor synchrotron data
Class: oxidoreductase
Keywords: pentose shunt, oxidoreductase, gluconate utilization
Deposited on 2006-07-23, released 2007-01-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.14
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96789 (2-End)
      • conflict (44)
    Domains in SCOPe 2.05: d2iz1a1, d2iz1a2
  • Chain 'B':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96789 (2-End)
      • expression tag (0-1)
      • conflict (44)
    Domains in SCOPe 2.05: d2iz1b1, d2iz1b2
  • Chain 'C':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating
    Species: LACTOCOCCUS LACTIS [TaxId:1358]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96789
      • conflict (44)
    Domains in SCOPe 2.05: d2iz1c1, d2iz1c2
  • Heterogens: ATR, RES, P33, PEG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iz1A (A:)
    hhmaqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktle
    efvgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaelads
    ginfigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgang
    aghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitke
    vlkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykder
    vkaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygti
    aqiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqagt
    piptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyted
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iz1A (A:)
    maqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktleef
    vgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsgi
    nfigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgangag
    hyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitkevl
    krkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykdervk
    askvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygtiaq
    iwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqagtpi
    ptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iz1B (B:)
    hhmaqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktle
    efvgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaelads
    ginfigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgang
    aghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitke
    vlkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykder
    vkaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygti
    aqiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqagt
    piptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyted
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iz1B (B:)
    hhmaqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktle
    efvgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaelads
    ginfigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgang
    aghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitke
    vlkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykder
    vkaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygti
    aqiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqagt
    piptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2iz1C (C:)
    hhmaqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktle
    efvgslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaelads
    ginfigtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgang
    aghyvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitke
    vlkrkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykder
    vkaskvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygti
    aqiwragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqagt
    piptftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyted
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iz1C (C:)
    aqanfgvvgmavmgknlalnvesrgytvaiynrttskteevfkehqdknlvftktleefv
    gslekprrimlmvqagaatdatiksllplldigdilidggnthfpdtmrrnaeladsgin
    figtgvsggekgallgpsmmpggqkeaydlvapifeqiaakapqdgkpcvaymgangagh
    yvkmvhngieygdmqliaesydllkrilglsnaeiqaifeewnegeldsylieitkevlk
    rkddegegyivdkildkagnkgtgkwtsesaldlgvplplitesvfaryistykdervka
    skvlsgpaldfsgdkkeviekirkalyfskimsyaqgfaqlrkaseefdwdlpygtiaqi
    wragciiraeflqnitdafdkdselenlllddyfvditkryqeavrdvvslavqagtpip
    tftsaisyydsyrsenlpanliqaqrdyfgahtyertdkagifhydwyt